PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB03G13340.1
Common NameLOC102705420
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 243aa    MW: 27859.3 Da    PI: 7.502
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB03G13340.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.94.9e-181562148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+ Ed ll d+v+q+G g+W+++a+  g++R++k+c++rw +yl
     OB03G13340.1 15 KGPWTALEDRLLTDYVQQHGEGSWNSVAKLTGLRRSGKSCRLRWVNYL 62
                     79********************************************97 PP

2Myb_DNA-binding53.17.1e-1768112147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg+ T++E+  +++++++lG++ W++Iar+++ gRt++++k++w+++
     OB03G13340.1  68 RGKITPDEETVILQLHAMLGNR-WSAIARCLP-GRTDNEIKNYWRTH 112
                      8999******************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.4951062IPR017930Myb domain
SuperFamilySSF466891.28E-3012109IPR009057Homeodomain-like
SMARTSM007171.2E-141464IPR001005SANT/Myb domain
PfamPF002491.5E-161562IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.4E-231669IPR009057Homeodomain-like
CDDcd001671.07E-101762No hitNo description
PROSITE profilePS5129423.40363117IPR017930Myb domain
SMARTSM007179.9E-1667115IPR001005SANT/Myb domain
PfamPF002499.0E-1568112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.5E-2470115IPR009057Homeodomain-like
CDDcd001676.79E-1172113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 243 aa     Download sequence    Send to blast
MDAISSLMLQ QGWRKGPWTA LEDRLLTDYV QQHGEGSWNS VAKLTGLRRS GKSCRLRWVN  60
YLRPDLKRGK ITPDEETVIL QLHAMLGNRW SAIARCLPGR TDNEIKNYWR THFKKARPSR  120
RARAQLLHQY QLQQQQQHRQ YLQSLSLLQQ QQQLQYLQQQ EQQQQLASLQ EQRRPPEAAA  180
DESMMAQVMA MSDLHATERC CAAVSLPDDD GVLPADDDAL WDSLWRLVDG DGSCGEGSSG  240
GEY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C6e-271511527126MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9604500.0EU960450.1 Zea mays clone 224989 MYB305 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006651026.11e-178PREDICTED: transcription factor MYB108-like
TrEMBLJ3LJV81e-178J3LJV8_ORYBR; Uncharacterized protein
STRINGOB03G13340.11e-178(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP132282433
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24310.11e-62myb domain protein 305